Shigella flexneri 301 (serotype 2a): SF2200 Help Entry SF2200            CDS       T00097                                  Name (RefSeq) DNA-damage-inducible protein   KO K12149   DNA-damage-inducible protein I Organism sfl  Shigella flexneri 301 (serotype 2a) Brite KEGG Orthology (KO) [BR:sfl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sfl03400]     SF2200 DNA repair and recombination proteins [BR:sfl03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     SF2200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MAPKK1_Int Motif Other DBs NCBI-GeneID:  1025354 NCBI-ProteinID:  NP_708018 UniProt:  A0A2S4MY63 A0AB36PFD9 LinkDB All DBs Position 2227584..2227832 Genome browser AA seq 82 aa AA seqDB search MRVEICIAKEKITKMPNGAVDALKEELTRRISKRYDDVEVIVKATSNDGLSVTRTADKDS AKTFVQETLKDTWESADEWFVH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgagatctgtatcgctaaagaaaaaatcactaaaatgccaaacggtgctgtg gatgcgttaaaggaagaattaacccgacgcatcagtaaacgttatgacgatgtagaggtg atcgtaaaagccaccagcaacgatggcctttctgttacacgcaccgcagataaggattct gcaaaaacatttgttcaggagactctgaaagatacctgggagtctgctgacgagtggttt gttcactaa

DBGET integrated database retrieval system