Shigella flexneri 301 (serotype 2a): SF3231 Help Entry SF3231            CDS       T00097                                  Symbol yrbB Name (RefSeq) hypothetical protein   KO K07122   phospholipid transport system transporter-binding protein Organism sfl  Shigella flexneri 301 (serotype 2a) Pathway sfl02010   ABC transporters Brite KEGG Orthology (KO) [BR:sfl00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     SF3231 (yrbB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:sfl02000]     SF3231 (yrbB) Transporters [BR:sfl02000]  ABC transporters, prokaryotic type   Saccharide, polyol, and lipid transporters    Phospholipid transporter     SF3231 (yrbB) SSDB OrthologParalogGFIT Motif Pfam:  STAS_2 STAS Yop-YscD_ppl_3rd Motif Other DBs NCBI-GeneID:  1026852 NCBI-ProteinID:  NP_708990 UniProt:  A0AB36PIA5 LinkDB All DBs Position complement(3329143..3329436) Genome browser AA seq 97 aa AA seqDB search MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLH LIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcgagtcactgagctggatgcagacgggtgacacgctggcgttatccggagagctg gatcaggacgttctgctaccgctttgggaaatgcgtgaggaggcggtgaaggggattacc tgcatcgatcttagccgtgtgtcccgcgtggatacggggggactggcactgctgctccat cttatcgatctggcgaaaaagcagggcaacaacgtgacgcttcagggggtaaacgacaaa gtgtataccctcgcgaaattgtataatttgcctgctgatgttctgcctcgttaa

DBGET integrated database retrieval system