Shigella flexneri 301 (serotype 2a): SF3649 Help Entry SF3649            CDS       T00097                                  Symbol grxC Name (RefSeq) glutaredoxin   KO K03676   glutaredoxin 3 Organism sfl  Shigella flexneri 301 (serotype 2a) Brite KEGG Orthology (KO) [BR:sfl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sfl03110]     SF3649 (grxC) Chaperones and folding catalysts [BR:sfl03110]  Protein folding catalysts   Protein disulfide isomerase    SF3649 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 SH3BGR GST_N Thioredoxin_2 Thioredoxin_3 CLIC-like_N Motif Other DBs NCBI-GeneID:  1026266 NCBI-ProteinID:  NP_709389 UniProt:  A0A0H2W0M7 A0AB36PJ20 LinkDB All DBs Position complement(3756786..3757037) Genome browser AA seq 83 aa AA seqDB search MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGCTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatgttgaaatctataccaaagaaacctgcccgtattgccatcgtgcaaaagca ctgctgagcagcaagggcgtgagtttccaggagttgccgatcgatggcaatgccgccaag cgtgaagagatgatcaaacgcagcggttgcaccacggttccccagatttttattgacgca cagcacattggcggctgtgatgacttgtatgcattggatgcacgtggtggactggatccc ctgctgaaataa

DBGET integrated database retrieval system