Sphingorhabdus sp. SMR4y: SPHFLASMR4Y_00991 Help Entry SPHFLASMR4Y_00991 CDS       T04949                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfla  Sphingorhabdus sp. SMR4y Pathway sfla01100   Metabolic pathways sfla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPHFLASMR4Y_00991    00074 Mycolic acid biosynthesis     SPHFLASMR4Y_00991   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPHFLASMR4Y_00991 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASK87765 UniProt:  A0A220W4P3 LinkDB All DBs Position 1033038..1033310 Genome browser AA seq 90 aa AA seqDB search MQDKVELTPEAAVRAVMRDILGLSEEQVAEFTAETELFGALPELDSMAVAGLLTELEDRL DIMIDDDEVDGELFETFGNLVAFAEMKVTE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcaagataaggtcgagttgacaccggaagctgccgtgcgtgcagtgatgcgggatatt ttgggactgagcgaggagcaagtcgctgaatttaccgcggaaacggagctttttggcgct cttcccgaactcgacagcatggccgttgcgggcttgctgaccgaactggaggaccggctg gacatcatgatcgacgatgatgaagtcgacggtgaactgttcgagactttcggcaatctg gtcgccttcgccgagatgaaagttaccgagtga

DBGET integrated database retrieval system