Sphingorhabdus sp. SMR4y: SPHFLASMR4Y_01865 Help Entry SPHFLASMR4Y_01865 CDS       T04949                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfla  Sphingorhabdus sp. SMR4y Pathway sfla01100   Metabolic pathways sfla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPHFLASMR4Y_01865    00074 Mycolic acid biosynthesis     SPHFLASMR4Y_01865   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPHFLASMR4Y_01865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF2827 Motif Other DBs NCBI-ProteinID:  ASK88611 LinkDB All DBs Position 1915031..1915276 Genome browser AA seq 81 aa AA seqDB search MANREEIMAKVGELIGPFNNKGVELTASTTFQGDLEWDSLTVMDFVAAVEDEFDIIITMN MQAEIETVGQLADAVAKLMES NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcaaatcgcgaagaaatcatggccaaggtcggagagctgatcgggccgttcaacaac aagggcgtcgaactgaccgccagcaccacttttcagggtgatctcgaatgggacagcctg acggtcatggactttgtcgctgcggtcgaagacgaatttgatatcatcatcaccatgaac atgcaggccgagatcgaaaccgtcggccagctcgccgatgccgtcgcaaagttgatggaa agctag

DBGET integrated database retrieval system