KEGG   Sphingorhabdus sp. SMR4y: SPHFLASMR4Y_02588
Entry
SPHFLASMR4Y_02588 CDS       T04949                                 
Symbol
afr
Name
(GenBank) 1,5-anhydro-D-fructose reductase
Organism
sfla  Sphingorhabdus sp. SMR4y
SSDB
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C3 GFO_IDH_MocA_C F420_oxidored Sacchrp_dh_NADP Toprim_3
Other DBs
NCBI-ProteinID: ASK89326
LinkDB
Position
2653776..2654810
AA seq 344 aa
MKTEPIGLALVGCGRISAAHLSAVAELDPAFRLVVTVDPDLTAAQAAAEPFGASAFADVP
KALAQPGIDAVLIASPNGMHFEQARMAIAAGKHVLVEKPLAETGAQALQLSEAAAAAGVI
LAAGHTFRHGAAVRTLMERLPDFGKLLSIEVSQCVFWDGPQAPWWAERTPEDGLILSLFA
PHALDFVQLVMGAADPLRMHVEAARHQTGWQAEDEAMMLFAYPDRKMATVHISYNQPHVH
DRKTLFFDKGVVVIEDGELLRWNGESLVEPAAGVLTDSSKMGGRDLSHYFSAQLSEFAKA
VRGESHCCPTGHDSARLIELLDRVREQALLNSGDAIRAQSEEKN
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaagactgaaccgataggcctcgccctggtgggctgtggcagaatcagcgccgcccat
ctttctgccgttgccgagctcgatcccgccttccggcttgtcgtgaccgtcgatccggat
ctgactgcagcgcaagcggctgccgaaccatttggtgcaagcgcttttgccgatgttccc
aaagcgctggcccagccaggcattgatgcggtgctgatagcaagccccaatggcatgcat
ttcgagcaggctcgcatggctatcgcggccggcaaacatgtgctggtcgaaaaaccgctt
gccgagaccggcgcgcaggcattgcagcttagtgaagcggccgctgcagccggtgtaata
ctggctgcagggcatacattccggcacggggcggcggtccggactttgatggagcgattg
ccagatttcgggaaactgctctcgatagaagtcagccaatgtgttttctgggatggaccg
caagccccctggtgggcggagcggacgccggaagacggcctgattctatcgctatttgcg
cctcatgcgcttgattttgtccagctcgtcatgggtgccgcagatccgttgcgcatgcat
gtcgaagcggcgcgacaccagaccgggtggcaggcggaagacgaggctatgatgttgttc
gcctatccggaccggaagatggccaccgtacacatatcttacaaccagccgcatgttcat
gatcgcaagacgcttttcttcgacaagggggtcgttgtgattgaagatggcgagctgctg
cgctggaatggcgaatcgcttgtcgagccagcagcgggtgtcttgaccgatagcagcaag
atgggcggtcgcgatctgtcccattatttcagcgcccagctatcggaatttgccaaagcc
gtgagaggcgagtcgcattgctgcccgacggggcacgactcggcgcggctgatcgaattg
ctggaccgcgtgcgcgagcaggccctgctcaatagcggtgatgcgatcagagcccaatcg
gaggagaaaaactga

DBGET integrated database retrieval system