Streptomyces flavusporus: ACKTSN_28150 Help Entry ACKTSN_28150      CDS       T11144                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sflu  Streptomyces flavusporus Pathway sflu00998   Biosynthesis of various antibiotics sflu01100   Metabolic pathways sflu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sflu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACKTSN_28150    00074 Mycolic acid biosynthesis     ACKTSN_28150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACKTSN_28150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 DUF6439 Motif Other DBs NCBI-ProteinID:  XLX09266 LinkDB All DBs Position 5940706..5940936 Genome browser AA seq 76 aa AA seqDB search MYEVLKGILVNDLQVREEDVLPTATREEVGLDSLAALELAEVLSSRLGIEIQDYELLDTT TLAEMAELVAGRQACG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgtacgaagtactcaagggcatcttggtgaacgacctccaggtgcgggaggaggacgtc ctgccgaccgccacccgggaggaggtcgggttggattcgctcgcggcgctcgaactggcg gaggtgctgagcagcaggctcggcatcgagatccaggactacgagctgctggacaccacc acgctcgccgagatggcggagctggtcgccggacggcaggcgtgtggctga

DBGET integrated database retrieval system