Scleropages formosus (Asian bonytongue): 108919432 Help Entry 108919432         CDS       T04919                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sfm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     108919432  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sfm04121]     108919432    03400 DNA repair and recombination proteins [BR:sfm03400]     108919432 Ubiquitin system [BR:sfm04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      108919432    Cul5 complex      108919432 DNA repair and recombination proteins [BR:sfm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      108919432 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  108919432 NCBI-ProteinID:  XP_018582915 UniProt:  A0A8D0CH27 LinkDB All DBs Position 20:complement(1833340..1836923) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLFKDDQILEDSKTLGDC GFTNQTARPQAPATIGLAFRINDDVFEQLRIDSFSTPPELPDVMKPQDSGSAASEQGVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatccgccgtcataagacgaccattttcacagatgccaaggaa tctaccacggtgtatgagttgaaacgcattgtggaaggcatcctgaaaaggccccctgag gaccagaggctcttcaaagatgaccagatactggaagacagtaagacattaggagattgt ggcttcactaatcaaacagcaagaccccaggcgccagctacaattggcctggctttccgc attaatgatgacgtctttgaacagctgcgaatcgattccttctcaacccctccggagctc cctgatgtcatgaagccccaggactccggaagtgctgccagtgaacagggcgtgcagtga

DBGET integrated database retrieval system