Scleropages formosus (Asian bonytongue): 108922695 Help Entry 108922695         CDS       T04919                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm03030   DNA replication sfm03082   ATP-dependent chromatin remodeling sfm03410   Base excision repair sfm03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sfm00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     108922695 (pole3)    03410 Base excision repair     108922695 (pole3)    03420 Nucleotide excision repair     108922695 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     108922695 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sfm03032]     108922695 (pole3)    03036 Chromosome and associated proteins [BR:sfm03036]     108922695 (pole3)    03400 DNA repair and recombination proteins [BR:sfm03400]     108922695 (pole3) Enzymes [BR:sfm01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      108922695 (pole3) DNA replication proteins [BR:sfm03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     108922695 (pole3) Chromosome and associated proteins [BR:sfm03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     108922695 (pole3) DNA repair and recombination proteins [BR:sfm03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       108922695 (pole3) SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP Bromo_TP Pox_Ag35 NOA36 DUF4746 CDC45 Motif Other DBs NCBI-GeneID:  108922695 NCBI-ProteinID:  XP_018588506 UniProt:  A0A0P7UMJ1 LinkDB All DBs Position 6:7535042..7537599 Genome browser AA seq 144 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPEGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVMAAMEEMEFERFIQPLQEALEAYKKGQRGKKEASEQKRKDREKKADDENDR SKEDNEEHMDEEQDDGEAEEEVEN NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggcggagagacccgaagacctgaacctccccaacgccgttatcacgcggatcatcaaa gaggcgctacccgagggagtgaacgtgtccaaggaggcgaggagggcgatctcccaggcg gccagcgtgttcgtcctctacgccacctcctgtgcaaacaactttgcaatgaaggctaaa aggaagacactaaatgcaggggatgtgatggcagccatggaggagatggagtttgagcgc ttcattcagccacttcaggaggctctggaagcatacaagaagggccaaaggggaaagaag gaagcctctgagcagaagcgcaaggacagagaaaagaaagcagatgatgaaaatgacagg agcaaggaggacaatgaagagcatatggatgaagaacaggatgatggagaagcagaagag gaagtggagaactga

DBGET integrated database retrieval system