Scleropages formosus (Asian bonytongue): 108923401 Help Entry 108923401         CDS       T04919                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04137   Mitophagy - animal sfm04140   Autophagy - animal sfm04144   Endocytosis sfm04145   Phagosome sfm04148   Efferocytosis sfm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfm00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108923401    04145 Phagosome     108923401    04140 Autophagy - animal     108923401    04137 Mitophagy - animal     108923401    04148 Efferocytosis     108923401  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108923401  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfm04131]     108923401   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfm04147]     108923401    04031 GTP-binding proteins [BR:sfm04031]     108923401 Membrane trafficking [BR:sfm04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108923401 Exosome [BR:sfm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108923401   Exosomal proteins of other body fluids (saliva and urine)    108923401   Exosomal proteins of colorectal cancer cells    108923401   Exosomal proteins of bladder cancer cells    108923401 GTP-binding proteins [BR:sfm04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108923401 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ABC_tran SRPRB ATP-synt_ab Motif Other DBs NCBI-GeneID:  108923401 NCBI-ProteinID:  XP_018589616 UniProt:  A0A8C9TGE8 LinkDB All DBs Position 22:24466739..24480440 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKSNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccagaaagaaagtgttactcaaagtcatcattctaggtgattcaggagttggg aagacttctctgatgaaccagtatgtgaataagaaatttagtaaccagtacaaagccaca ataggtgctgactttctgacgaaagaggtgatggtggatgacagacttgttacaatgcag atctgggacacggcagggcaggagcgcttccagtcactgggagtggccttttaccgtgga gcagactgctgtgtattagtgtttgatgtgactgcacctaacaccttcaagaccctagac agctggagagatgagtttctgatccaggccagccctcgtgatccagagaacttcccattt gtggtgttaggcaacaaaattgacctggagaacaggcaggtaacgacaaagcgagcacag gcctggtgtcagagtaagagcaatatcccctactttgaaaccagtgccaaggaagctatc aatgtagagcaggccttccagaccatcgcacgcaatgcactgaagcaggagacggaggtt gagttgtacaacgaattcccagagccgataaaactggacagaaatgagcgagccaagcca tcagcagagacctgcagctgctga

DBGET integrated database retrieval system