Scleropages formosus (Asian bonytongue): 108925470 Help Entry 108925470         CDS       T04919                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04382   Cornified envelope formation sfm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfm00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     108925470  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108925470  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfm04147]     108925470 Exosome [BR:sfm04147]  Exosomal proteins   Exosomal proteins of microglial cells    108925470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH Motif Other DBs NCBI-GeneID:  108925470 NCBI-ProteinID:  XP_018592951 UniProt:  A0A8C9SDW9 LinkDB All DBs Position 18:17720064..17722301 Genome browser AA seq 103 aa AA seqDB search MPTELERAMEILLCQFHKYACKEGKSNSLSRCELKKLMENELPTFLKSQKDPGAVDKIFK DLDCDGDGEVNFQEYLSLIGGLSLSCNQLYEMHLRQQNQQCKK NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgccaacagagctggagagagccatggagatccttctttgtcagttccacaagtatgcc tgcaaagaagggaagtccaactccctctcccggtgcgagttaaagaagctcatggagaat gagctgcccactttccttaagtctcagaaggatcctggtgctgtggacaagatctttaag gatctggactgtgatggtgatggagaggtcaactttcaggagtatttgtccctgattgga ggcctgtcattgtcctgcaaccagttatacgaaatgcacttgaggcaacagaatcaacag tgcaagaagtga

DBGET integrated database retrieval system