Scleropages formosus (Asian bonytongue): 108925877 Help Entry 108925877         CDS       T04919                                  Symbol txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04621   NOD-like receptor signaling pathway sfm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfm00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108925877 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108925877 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sfm03110]     108925877 (txn) Chaperones and folding catalysts [BR:sfm03110]  Protein folding catalysts   Protein disulfide isomerase    108925877 (txn) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin AhpC-TSA Redoxin DIM1 Thioredoxin_8 OST3_OST6 Thioredoxin_7 DUF6568 Thioredoxin_2 Thioredoxin_9 Thioredox_DsbH TXD17-like_Trx NAD-bd_HRPKS_sdrA Motif Other DBs NCBI-GeneID:  108925877 NCBI-ProteinID:  XP_018593721 UniProt:  A0A8C9VRY8 LinkDB All DBs Position 16:756563..758503 Genome browser AA seq 110 aa AA seqDB search MIVVIEDQDAFDQALADAGDKLVVVEFSASWCGPCNTIAPFFEELSEREENQNIVFLKVD VDDAQDVANFCDIKCMPTFHFYKNGKKMDNFSGSSSEKLEQLLKEHRCSE NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgatcgttgtgatcgaagatcaggacgccttcgaccaggccctcgcagatgctggagac aagctggtcgtggtggaattctcagccagctggtgtggaccatgcaacaccatcgcaccc ttcttcgaggagctctcagaaagggaggaaaaccagaacattgtgtttctgaaggtggat gtggatgatgcccaggacgtggccaacttctgcgacatcaagtgcatgcccacgttccac ttctacaagaacggcaagaagatggacaacttctcgggctccagcagcgagaagctggag cagcttttgaaggagcacaggtgtagcgagtga

DBGET integrated database retrieval system