Scleropages formosus (Asian bonytongue): 108925891 Help Entry 108925891         CDS       T04919                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm03030   DNA replication sfm03410   Base excision repair sfm03420   Nucleotide excision repair sfm03430   Mismatch repair sfm03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sfm00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     108925891 (pold4)    03410 Base excision repair     108925891 (pold4)    03420 Nucleotide excision repair     108925891 (pold4)    03430 Mismatch repair     108925891 (pold4)    03440 Homologous recombination     108925891 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sfm03032]     108925891 (pold4)    03400 DNA repair and recombination proteins [BR:sfm03400]     108925891 (pold4) DNA replication proteins [BR:sfm03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     108925891 (pold4) DNA repair and recombination proteins [BR:sfm03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       108925891 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      108925891 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  108925891 NCBI-ProteinID:  XP_029114879 LinkDB All DBs Position 16:complement(633043..635444) Genome browser AA seq 112 aa AA seqDB search MSPKRRLITDSFKVVKRARAEQRVEKKEEEPPEPPEPEPESRSLTPREKDLQELRKFDLD WRFGPCTGIGRLQRWDRASHHGLDPPREVRELLLKKSADPEYTHCLWHELPL NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtctcctaagcgcagactcatcacggactctttcaaagtggtgaaaagagcgcgcgca gagcagagagtggagaagaaggaggaggagccgccggagccgccggagccagagcccgag tcccgctccctcactccccgcgagaaggacctgcaggaactcaggaagttcgacttggac tggcgctttggaccctgcaccggaatcggccgtctccagcgctgggacagggcctcccac cacggcttggacccccccagggaggtgcgagagctgctgctgaagaagagtgcagatcca gagtacacacattgtctgtggcacgaactcccgttgtga

DBGET integrated database retrieval system