Scleropages formosus (Asian bonytongue): 108925901 Help Entry 108925901         CDS       T04919                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04060   Cytokine-cytokine receptor interaction sfm04218   Cellular senescence sfm04620   Toll-like receptor signaling pathway sfm04621   NOD-like receptor signaling pathway sfm04622   RIG-I-like receptor signaling pathway sfm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfm00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108925901  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     108925901  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108925901    04621 NOD-like receptor signaling pathway     108925901    04622 RIG-I-like receptor signaling pathway     108925901  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108925901  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfm04052]     108925901    00536 Glycosaminoglycan binding proteins [BR:sfm00536]     108925901 Cytokines and neuropeptides [BR:sfm04052]  Cytokines   Chemokines    108925901 Glycosaminoglycan binding proteins [BR:sfm00536]  Heparan sulfate / Heparin   Chemokines    108925901 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  108925901 NCBI-ProteinID:  XP_029114880 UniProt:  A0A8C9VED5 LinkDB All DBs Position 16:complement(813547..815366) Genome browser AA seq 98 aa AA seqDB search MNPRLRGSAFIVLLAALSIVEGMGVRGIGMEPRCRCIKTESRRIGSYIQKVELFPPSPQC EDTEIIATMKRSGREICLEPTAPWVKKVIEKILANNEP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaccccagactcagaggctccgcgttcattgtcctgctggctgctctgagcattgtt gaggggatgggcgttagaggaatcggaatggagccgcgctgccgctgcatcaagacggag agccggcgcatcggcagctacatccagaaagtggagctgtttcctccgagcccccagtgc gaggacaccgagatcatcgccactatgaagaggagcgggcgggagatctgcctggagccc acggctccgtgggtcaagaaggtcatcgagaagatcttggccaacaatgaaccttga

DBGET integrated database retrieval system