Scleropages formosus (Asian bonytongue): 108928283 Help Entry 108928283         CDS       T04919                                  Symbol nras Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04010   MAPK signaling pathway sfm04012   ErbB signaling pathway sfm04068   FoxO signaling pathway sfm04137   Mitophagy - animal sfm04140   Autophagy - animal sfm04150   mTOR signaling pathway sfm04210   Apoptosis sfm04218   Cellular senescence sfm04370   VEGF signaling pathway sfm04371   Apelin signaling pathway sfm04540   Gap junction sfm04625   C-type lectin receptor signaling pathway sfm04810   Regulation of actin cytoskeleton sfm04910   Insulin signaling pathway sfm04912   GnRH signaling pathway sfm04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sfm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108928283 (nras)    04012 ErbB signaling pathway     108928283 (nras)    04370 VEGF signaling pathway     108928283 (nras)    04371 Apelin signaling pathway     108928283 (nras)    04068 FoxO signaling pathway     108928283 (nras)    04150 mTOR signaling pathway     108928283 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108928283 (nras)    04137 Mitophagy - animal     108928283 (nras)   09143 Cell growth and death    04210 Apoptosis     108928283 (nras)    04218 Cellular senescence     108928283 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     108928283 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108928283 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108928283 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     108928283 (nras)    04912 GnRH signaling pathway     108928283 (nras)    04916 Melanogenesis     108928283 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfm04131]     108928283 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfm04147]     108928283 (nras)    04031 GTP-binding proteins [BR:sfm04031]     108928283 (nras) Membrane trafficking [BR:sfm04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     108928283 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     108928283 (nras) Exosome [BR:sfm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108928283 (nras)   Exosomal proteins of other body fluids (saliva and urine)    108928283 (nras)   Exosomal proteins of breast cancer cells    108928283 (nras)   Exosomal proteins of colorectal cancer cells    108928283 (nras) GTP-binding proteins [BR:sfm04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108928283 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin VapE-like_dom G-alpha Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  108928283 NCBI-ProteinID:  XP_029105137 LinkDB All DBs Position 25:complement(2345081..2357164) Genome browser AA seq 199 aa AA seqDB search MSSSSVLAEGTMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGE TCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDV PMVLVGNKCDLARTVDTKQAQELARSYGIQFVETSAKTRQGVEDAFYTLVREIRHYRMKK LNSGEDRNQGCLGLSCAVM NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcttcagtcctggctgagggcacaatgacggagtacaagctggtggtggtg ggggcgggcggcgtgggcaagagcgcgctcaccatccagctcatccagaaccactttgtg gacgagtacgacccgacgatcgaggactcgtacaggaagcaggtggtgattgacggcgaa acgtgcctactggacatcctggacacggccggacaggaggagtacagcgccatgcgggat cagtacatgaggacaggggaaggattcctgtgtgtgtttgccatcaacaacagcaagtct tttgctgatgttcacctgtacagggaacagataaaacgggtcaaagactcagacgacgtt cccatggtgctggtgggcaacaagtgtgacctggcacgcaccgtggacacgaagcaggcg caggagctggcccgcagttacggcattcagtttgtggagacctctgccaagactagacag ggtgtggaggacgccttctacacactggtgcgtgagatccgccactaccgcatgaagaag ctcaacagcggagaggaccggaaccagggctgcctgggactctcctgtgcagtcatgtga

DBGET integrated database retrieval system