Scleropages formosus (Asian bonytongue): 108934283 Help Entry 108934283         CDS       T04919                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04010   MAPK signaling pathway sfm04068   FoxO signaling pathway sfm04081   Hormone signaling sfm04114   Oocyte meiosis sfm04140   Autophagy - animal sfm04150   mTOR signaling pathway sfm04810   Regulation of actin cytoskeleton sfm04910   Insulin signaling pathway sfm04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:sfm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108934283 (ins)    04068 FoxO signaling pathway     108934283 (ins)    04150 mTOR signaling pathway     108934283 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     108934283 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108934283 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     108934283 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108934283 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     108934283 (ins)    04914 Progesterone-mediated oocyte maturation     108934283 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfm04052]     108934283 (ins) Cytokines and neuropeptides [BR:sfm04052]  Neuropeptides   Unclassified    108934283 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta ODV-E18 Motif Other DBs NCBI-GeneID:  108934283 NCBI-ProteinID:  XP_018607388 UniProt:  A0A0P7TWG1 LinkDB All DBs Position 4:35205455..35206694 Genome browser AA seq 111 aa AA seqDB search MAIWLQAFPLLVLLVLSSSPGAESSSSQRLCGSHLVDALYMVCGDRGFFYSPKSRREAEP LLGFLSPKSGQENEVDEYPYKEQGELKVKRGIVEQCCHKPCNLFELQNYCN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcgatttggctccaggcattccctctgctggtcctgctggtcctttcctcctcccca ggggcagagtccagctcaagccagcgcctgtgcggctcccacctggtggacgccctctac atggtttgcggggaccgcggcttcttctacagccccaaaagtaggagggaggcggaacca ctgctgggtttcttgtctcccaaatcaggccaagagaacgaagtggacgaatacccctac aaggagcagggtgagctgaaggtgaagagaggcattgtggagcagtgctgtcacaagccc tgcaacctctttgagctgcagaactactgcaactga

DBGET integrated database retrieval system