Scleropages formosus (Asian bonytongue): 108934636 Help Entry 108934636         CDS       T04919                                  Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04010   MAPK signaling pathway sfm04012   ErbB signaling pathway sfm04068   FoxO signaling pathway sfm04137   Mitophagy - animal sfm04140   Autophagy - animal sfm04144   Endocytosis sfm04150   mTOR signaling pathway sfm04210   Apoptosis sfm04218   Cellular senescence sfm04370   VEGF signaling pathway sfm04371   Apelin signaling pathway sfm04510   Focal adhesion sfm04519   Cadherin signaling sfm04540   Gap junction sfm04625   C-type lectin receptor signaling pathway sfm04810   Regulation of actin cytoskeleton sfm04910   Insulin signaling pathway sfm04912   GnRH signaling pathway sfm04916   Melanogenesis sfm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108934636    04012 ErbB signaling pathway     108934636    04370 VEGF signaling pathway     108934636    04371 Apelin signaling pathway     108934636    04068 FoxO signaling pathway     108934636    04150 mTOR signaling pathway     108934636   09133 Signaling molecules and interaction    04519 Cadherin signaling     108934636  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108934636    04140 Autophagy - animal     108934636    04137 Mitophagy - animal     108934636   09143 Cell growth and death    04210 Apoptosis     108934636    04218 Cellular senescence     108934636   09144 Cellular community - eukaryotes    04510 Focal adhesion     108934636    04540 Gap junction     108934636   09142 Cell motility    04810 Regulation of actin cytoskeleton     108934636  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108934636   09152 Endocrine system    04910 Insulin signaling pathway     108934636    04912 GnRH signaling pathway     108934636    04916 Melanogenesis     108934636  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108934636  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfm04131]     108934636   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfm04147]     108934636    04031 GTP-binding proteins [BR:sfm04031]     108934636 Membrane trafficking [BR:sfm04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     108934636  Endocytosis   Macropinocytosis    Ras GTPases     108934636 Exosome [BR:sfm04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    108934636   Exosomal proteins of colorectal cancer cells    108934636 GTP-binding proteins [BR:sfm04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108934636 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  108934636 NCBI-ProteinID:  XP_018608108 UniProt:  A0A8C9TRP8 LinkDB All DBs Position 11:2251022..2265425 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDSGQD CLNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtcgtggtgggagctggaggtgtgggcaaaagcgcactgaca atccagttgatccagaaccactttgtggatgagtatgaccccacgatcgaggactcgtac aggaagcaggtggtaatcgatggggagacatgtctgctggacatcctggacacggccggc caggaggagtacagcgccatgcgggaccagtacatgaggacgggagagggcttcctctgc gtcttcgctatcaacaacaccaagtccttcgaggacattcaccagtacagggaacagatc aaacgggtgaaggactcggacgacgttcccatggtgctggtgggaaacaaatgtgacctc ccggctcgtacggtggacacaaggcaggcccaggagctggcgcgcagctacggcatcccc tacatcgagacctcggccaagacccgccagggagtggaggacgccttctacacgctggtc cgtgagatcaggcagcacaaactgcgcaagctgaaccctccggacgacagcggacaggac tgtttgaactgccgctgcgtcgtgtcgtga

DBGET integrated database retrieval system