Scleropages formosus (Asian bonytongue): 108941689 Help Entry 108941689         CDS       T04919                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04010   MAPK signaling pathway sfm04137   Mitophagy - animal sfm04140   Autophagy - animal sfm04218   Cellular senescence sfm04371   Apelin signaling pathway sfm04625   C-type lectin receptor signaling pathway sfm04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:sfm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108941689 (rras)    04371 Apelin signaling pathway     108941689 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108941689 (rras)    04137 Mitophagy - animal     108941689 (rras)   09143 Cell growth and death    04218 Cellular senescence     108941689 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108941689 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108941689 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfm04147]     108941689 (rras)    04031 GTP-binding proteins [BR:sfm04031]     108941689 (rras) Exosome [BR:sfm04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108941689 (rras)   Exosomal proteins of bladder cancer cells    108941689 (rras) GTP-binding proteins [BR:sfm04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108941689 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  108941689 NCBI-ProteinID:  XP_018619990 UniProt:  A0A8C9R1U8 LinkDB All DBs Position 8:32284707..32288263 Genome browser AA seq 199 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKQTRMDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLEQQRTVSRDEAQTFARENRIHYMESSAKNRLNVDEAFYEVARAIRKFQETESPPLP SHHTGKQKSSGGGCPCTLL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgtcagccgaagaggagcggttcaaacttgtcgtggtgggtggaggtggcgtgggcaag agtgccttaaccatccagttcatacagtcatactttgtgtccgattatgaccccaccatt gaggactcgtacaccaagatatgcactgtggacggaaagcagaccaggatggacatcctg gacacggcgggccaggaggagtttggcgccatgcgggagcagtacatgcgctccggagag ggcttcctgctcgtgttcgccctcaacgaccggggcagctacaacgagatccacaagttc cacacacagatcctgagggtcaaggaccgagacgacttccccatggtgctcgtcgggaac aaggcggacctggagcagcagaggacggtgtccagggacgaggcgcagaccttcgccagg gagaaccgcatccactacatggagtcctcggccaagaaccggctcaacgtggacgaggct ttttacgaggtggcgcgcgccatacgaaagtttcaggagaccgagagccccccccttcca tcacaccacacgggcaaacagaagagctccggcggcggctgcccctgtaccctgctgtaa

DBGET integrated database retrieval system