Scleropages formosus (Asian bonytongue): 114909046 Help Entry 114909046         CDS       T04919                                  Name (RefSeq) GTPase KRas-like   KO K07827   GTPase KRas Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04010   MAPK signaling pathway sfm04012   ErbB signaling pathway sfm04068   FoxO signaling pathway sfm04137   Mitophagy - animal sfm04140   Autophagy - animal sfm04150   mTOR signaling pathway sfm04210   Apoptosis sfm04218   Cellular senescence sfm04370   VEGF signaling pathway sfm04371   Apelin signaling pathway sfm04540   Gap junction sfm04625   C-type lectin receptor signaling pathway sfm04810   Regulation of actin cytoskeleton sfm04910   Insulin signaling pathway sfm04912   GnRH signaling pathway sfm04914   Progesterone-mediated oocyte maturation sfm04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sfm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114909046    04012 ErbB signaling pathway     114909046    04370 VEGF signaling pathway     114909046    04371 Apelin signaling pathway     114909046    04068 FoxO signaling pathway     114909046    04150 mTOR signaling pathway     114909046  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114909046    04137 Mitophagy - animal     114909046   09143 Cell growth and death    04210 Apoptosis     114909046    04218 Cellular senescence     114909046   09144 Cellular community - eukaryotes    04540 Gap junction     114909046   09142 Cell motility    04810 Regulation of actin cytoskeleton     114909046  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114909046   09152 Endocrine system    04910 Insulin signaling pathway     114909046    04912 GnRH signaling pathway     114909046    04914 Progesterone-mediated oocyte maturation     114909046    04916 Melanogenesis     114909046  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfm04131]     114909046   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sfm04031]     114909046 Membrane trafficking [BR:sfm04131]  Endocytosis   Macropinocytosis    Ras GTPases     114909046 GTP-binding proteins [BR:sfm04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     114909046 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase MeaB FeoB_N ATP_bind_1 G1_gp67_C Septin Motif Other DBs NCBI-GeneID:  114909046 NCBI-ProteinID:  XP_029105461 LinkDB All DBs Position 2:1814554..1819272 Genome browser AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFEDIHNYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKEGKKKKKS KNKCMVM NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggtgggggcgggaggcgtcgggaagagtgcgctgaca atacagctgattcagaaccactttgtggacgagtacgatcccaccattgaggactcctat cgtaagcaggtggtgatcgatggggagacatgtctgctggacattctggacacggcaggg caggaagagtatagcgccatgcgagaccagtatatgagaacaggagagggcttcctatgt gtctttgccatcaacaatagcaagtcgttcgaggacattcacaactacagagaacagatc aagcgtgtgaaagactctgaggatgtcccaatggtgctggtgggaaacaagtgtgacctg ccatcccgaacagtggacacaaagcaagctcaggatctggccaggagctatggcattccc ttcatagagacatctgctaagacaagacagggtgtggatgacgccttctacactttagtg agggaaattcgcaaacacaaggagaagatgagcaaagaggggaagaagaaaaagaagtca aagaacaagtgtatggtcatgtga

DBGET integrated database retrieval system