Shigella flexneri 2003036: SFy_0890 Help Entry SFy_0890          CDS       T03267                                  Name (GenBank) hypothetical protein   KO K03425   sec-independent protein translocase protein TatE Organism sfn  Shigella flexneri 2003036 Pathway sfn03060   Protein export sfn03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sfn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SFy_0890  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SFy_0890  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sfn02044]     SFy_0890 Secretion system [BR:sfn02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SFy_0890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AIL34630 LinkDB All DBs Position complement(670868..671071) Genome browser AA seq 67 aa AA seqDB search MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMNDDDAAAKKGADVDLQA EKLSHKE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgggtgagattagtattaccaaactgctggtagttgcggcgctggtcgttctgctgttt gggactaagaagttacgtacgctgggcggagaccttggagcggccattaaagggttcaag aaggcgatgaatgatgacgatgctgcggcgaaaaaaggcgcagacgttgatcttcaggct gaaaagctctctcataaagagtga

DBGET integrated database retrieval system