Shigella flexneri 2003036: SFy_1539 Help Entry SFy_1539          CDS       T03267                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism sfn  Shigella flexneri 2003036 Brite KEGG Orthology (KO) [BR:sfn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sfn03400]     SFy_1539 DNA repair and recombination proteins [BR:sfn03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     SFy_1539 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  AIL35139 LinkDB All DBs Position complement(1132934..1133179) Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNLSVIGATKEDK QRISEILQETWESADDWFVSE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgaattgaagtcaccatagcgaaaacttctccattgccagctggggctattgacgcc ctggctggcgaactttcccgccgtattcagtatgcgtttcctgataatgaaggccacgta tcggtacgttatgccgcagcgaataatttatcggttattggcgcaacaaaagaagataaa cagcgcattagcgaaattctccaggaaacgtgggaaagcgccgatgactggtttgtcagc gaataa

DBGET integrated database retrieval system