Shigella flexneri 2003036: SFy_1584 Help Entry SFy_1584          CDS       T03267                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sfn  Shigella flexneri 2003036 Pathway sfn01100   Metabolic pathways sfn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SFy_1584    00074 Mycolic acid biosynthesis     SFy_1584   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SFy_1584 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AIL35177 LinkDB All DBs Position 1163194..1163430 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system