Shigella flexneri 2003036: SFy_4313 Help Entry SFy_4313          CDS       T03267                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sfn  Shigella flexneri 2003036 Pathway sfn01100   Metabolic pathways sfn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SFy_4313    00074 Mycolic acid biosynthesis     SFy_4313   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SFy_4313 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIL37309 LinkDB All DBs Position 3120525..3120752 Genome browser AA seq 75 aa AA seqDB search MDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPINILLDVKT PAQLMETLLPWLENK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggattacatcctttcctgtttacaggatttggtcgaaaacggtgtggaaattaagccc gacagcgatctcgtcaacgatcttggcctggagtcgatcaaagtgatggatctcttaatg atgctggaagacagattcgatatttccattcctattaatattctgctggatgtcaaaacc cctgcgcaattaatggaaactctacttccatggctggagaataaataa

DBGET integrated database retrieval system