Shigella flexneri 2003036: SFy_5202 Help Entry SFy_5202          CDS       T03267                                  Name (GenBank) GrxC   KO K03676   glutaredoxin 3 Organism sfn  Shigella flexneri 2003036 Brite KEGG Orthology (KO) [BR:sfn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sfn03110]     SFy_5202 Chaperones and folding catalysts [BR:sfn03110]  Protein folding catalysts   Protein disulfide isomerase    SFy_5202 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 SH3BGR GST_N Thioredoxin_3 Thioredoxin_2 CLIC-like_N Motif Other DBs NCBI-ProteinID:  AIL37983 LinkDB All DBs Position complement(3752534..3752785) Genome browser AA seq 83 aa AA seqDB search MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGCTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatgttgaaatctataccaaagaaacctgcccgtattgccatcgtgcaaaagca ctgctgagcagcaagggcgtgagtttccaggagttgccgatcgatggcaatgccgccaag cgtgaagagatgatcaaacgcagcggttgcaccacggttccccagatttttattgacgca cagcacattggcggctgtgatgacttgtatgcattggatgcacgtggtggactggatccc ctgctgaaataa

DBGET integrated database retrieval system