Shigella flexneri 2003036: SFy_5582 Help Entry SFy_5582          CDS       T03267                                  Name (GenBank) TaTA   KO K03116   sec-independent protein translocase protein TatA Organism sfn  Shigella flexneri 2003036 Pathway sfn03060   Protein export sfn03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sfn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SFy_5582  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SFy_5582  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sfn02044]     SFy_5582 Secretion system [BR:sfn02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SFy_5582 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF4834 Motif Other DBs NCBI-ProteinID:  AIL38262 LinkDB All DBs Position 4024266..4024535 Genome browser AA seq 89 aa AA seqDB search MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFT AKTIADKQADTNQEQAKTEDAKRHDKEQV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgggtggtatcagtatttggcagttattgattattgccgtcatcgttgtactgcttttt ggcaccaaaaagctcggctccatcggttccgatcttggtgcgtcgatcaaaggctttaaa aaagcaatgagcgatgatgaaccaaagcaggataaaaccagtcaggatgctgattttact gcgaaaactatcgccgataagcaggcggatacgaatcaggaacaggctaaaacagaagac gcgaagcgccacgataaagagcaggtgtaa

DBGET integrated database retrieval system