Stenotrophomonas forensis: K5L94_04645 Help Entry K5L94_04645       CDS       T10605                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfoe  Stenotrophomonas forensis Pathway sfoe01100   Metabolic pathways sfoe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfoe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K5L94_04645 (acpP)    00074 Mycolic acid biosynthesis     K5L94_04645 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K5L94_04645 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WDM64581 UniProt:  A0ABY7Y3N1 LinkDB All DBs Position 1000521..1000760 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTNSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKISTVQAAIDYVKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacagcttggcgtcaaggaa gaagaagtcaccaacagcgcatcgttcgtcgatgacctgggcgctgactcgctggacacc gtcgagctggtgatggccctggaagaagaattcgagtgcgagatcccggacgaagaagcc gagaagatcagcaccgtgcaggccgccatcgactacgtcaaggcccacgtcaaggcctga

DBGET integrated database retrieval system