Spirosoma foliorum: H3H32_15220 Help Entry H3H32_15220       CDS       T09363                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfol  Spirosoma foliorum Pathway sfol01100   Metabolic pathways sfol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3H32_15220    00074 Mycolic acid biosynthesis     H3H32_15220   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3H32_15220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QMW06140 UniProt:  A0A7G5H4U8 LinkDB All DBs Position complement(3614572..3614817) Genome browser AA seq 81 aa AA seqDB search MTLSQINNRLQEILASIGISLTALTDQASFARDLGLDSLDITDLMLQVETSFNIRIPDED WWKLQTVGQLKNYLADEMIFD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacactatctcaaataaataaccgccttcaagagattcttgccagcatcggcatcagc ttaacggctctgactgatcaggccagtttcgctcgggacctgggacttgattcgctcgat attaccgacttaatgcttcaggttgaaaccagtttcaatattcgtattcccgacgaagac tggtggaaactccagacggttgggcagttgaagaattacctggccgatgaaatgattttt gattga

DBGET integrated database retrieval system