Spirosoma foliorum: H3H32_29550 Help Entry H3H32_29550       CDS       T09363                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfol  Spirosoma foliorum Pathway sfol01100   Metabolic pathways sfol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3H32_29550    00074 Mycolic acid biosynthesis     H3H32_29550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3H32_29550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  QMW02038 UniProt:  A0A7G5GT46 LinkDB All DBs Position 7024932..7025171 Genome browser AA seq 79 aa AA seqDB search MSDIAQKVKNIIVEKLGVEESEVTPEASFTNDLGADSLDTVELIMEFEKEFNLPIPDDEA EKISTVGLAIEYLEKHIGK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcggacattgcacaaaaagttaagaatatcattgttgagaaactgggtgttgaagag tcagaagtaacgccagaagcaagcttcaccaacgatctgggtgccgattcgctcgataca gttgagctgatcatggaatttgaaaaagaattcaacttgcctatccccgacgacgaggct gaaaaaatctctaccgttggtttggccatcgaatatctggaaaaacacatcggcaagtaa

DBGET integrated database retrieval system