Salvelinus fontinalis (brook trout): 129815089 Help Entry 129815089         CDS       T11136                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism sfon  Salvelinus fontinalis (brook trout) Pathway sfon04137   Mitophagy - animal sfon04140   Autophagy - animal sfon04144   Endocytosis sfon04145   Phagosome sfon04148   Efferocytosis sfon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfon00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129815089    04145 Phagosome     129815089    04140 Autophagy - animal     129815089    04137 Mitophagy - animal     129815089    04148 Efferocytosis     129815089  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129815089  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfon04131]     129815089   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfon04147]     129815089    04031 GTP-binding proteins [BR:sfon04031]     129815089 Membrane trafficking [BR:sfon04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     129815089 Exosome [BR:sfon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129815089   Exosomal proteins of other body fluids (saliva and urine)    129815089   Exosomal proteins of colorectal cancer cells    129815089   Exosomal proteins of bladder cancer cells    129815089 GTP-binding proteins [BR:sfon04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     129815089 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  129815089 NCBI-ProteinID:  XP_055724417 LinkDB All DBs Position 18:complement(17163833..17171070) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERSKPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtctaggaagaaagtactacttaaagtaatcattctgggagactctggagttggg aagacttccctgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca attggagctgattttctgacgaaagaagtgatggtggacgacaggcttgtcaccatgcag atctgggacacagcggggcaggagaggttccagtctctgggtgtggcgttctaccgcggg gcagactgttgcgtgctggtgtttgacgtgaccgcccccaacaccttcaagaccctagac agctggagagacgaattcctcatacaggccagcccccgagaccccgagaacttccccttc gtggtgctaggcaacaagattgacctggagaacagacaggtgacgactaaacgagcacag gcctggtgtcagagcaagaacaacatcccctacttcgagaccagcgcaaaggaggccatc aacgttgaacaggctttccagactattgcacgcaatgctcttaaacaggagacagaggtg gagttgtacaatgagttccctgaaccgataaagctggacaggaacgaacgttccaagcca tcagcggaggcctgcagctgctga

DBGET integrated database retrieval system