Salvelinus fontinalis (brook trout): 129823248 Help Entry 129823248         CDS       T11136                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism sfon  Salvelinus fontinalis (brook trout) Pathway sfon04010   MAPK signaling pathway sfon04137   Mitophagy - animal sfon04140   Autophagy - animal sfon04218   Cellular senescence sfon04371   Apelin signaling pathway sfon04625   C-type lectin receptor signaling pathway sfon04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:sfon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129823248 (rras)    04371 Apelin signaling pathway     129823248 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129823248 (rras)    04137 Mitophagy - animal     129823248 (rras)   09143 Cell growth and death    04218 Cellular senescence     129823248 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129823248 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129823248 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfon04147]     129823248 (rras)    04031 GTP-binding proteins [BR:sfon04031]     129823248 (rras) Exosome [BR:sfon04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129823248 (rras)   Exosomal proteins of bladder cancer cells    129823248 (rras) GTP-binding proteins [BR:sfon04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129823248 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  129823248 NCBI-ProteinID:  XP_055738132 LinkDB All DBs Position 2:64099757..64115424 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICIVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLDQSRVISREEAQGFARENRIHYMEASAKNRHNVDEAFLEVVRAIRKFQETESPPLP ANHTGKRKSGGCPCTLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaggaggagagattcaaactggtcgtcgtgggcgggggcggtgtggggaaa agcgccttgaccatacaattcattcagtcatactttgtatcggattatgaccccaccatc gaggactcctacaccaaaatatgcatagtggatgggaaagagacacgattagacatcttg gacacagcaggtcaggaggagtttggggcaatgagggagcagtacatgcgctcaggagaa ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac aaggctgacctggaccagtcgagagtgatctccagagaggaggcccagggctttgccaga gagaacaggatccattacatggaggcctcggctaagaaccgccacaatgtagacgaagcc ttcctggaggtcgtgcgagctataagaaagtttcaggagactgagagtccccctctacct gcaaaccacacaggaaaacggaaaagcggtggctgcccctgcaccctcctttaa

DBGET integrated database retrieval system