Salvelinus fontinalis (brook trout): 129823248 Help Entry 129823248         CDS       T11136                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism sfon  Salvelinus fontinalis (brook trout) Pathway sfon04010   MAPK signaling pathway sfon04137   Mitophagy - animal sfon04140   Autophagy - animal sfon04218   Cellular senescence sfon04371   Apelin signaling pathway sfon04519   Cadherin signaling sfon04625   C-type lectin receptor signaling pathway sfon04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:sfon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129823248 (rras)    04371 Apelin signaling pathway     129823248 (rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     129823248 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129823248 (rras)    04137 Mitophagy - animal     129823248 (rras)   09143 Cell growth and death    04218 Cellular senescence     129823248 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129823248 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129823248 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfon04147]     129823248 (rras)    04031 GTP-binding proteins [BR:sfon04031]     129823248 (rras) Exosome [BR:sfon04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129823248 (rras)   Exosomal proteins of bladder cancer cells    129823248 (rras) GTP-binding proteins [BR:sfon04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129823248 (rras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  129823248 NCBI-ProteinID:  XP_055738132 LinkDB All DBs Position 2:64099757..64115424 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICIVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLDQSRVISREEAQGFARENRIHYMEASAKNRHNVDEAFLEVVRAIRKFQETESPPLP ANHTGKRKSGGCPCTLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaggaggagagattcaaactggtcgtcgtgggcgggggcggtgtggggaaa agcgccttgaccatacaattcattcagtcatactttgtatcggattatgaccccaccatc gaggactcctacaccaaaatatgcatagtggatgggaaagagacacgattagacatcttg gacacagcaggtcaggaggagtttggggcaatgagggagcagtacatgcgctcaggagaa ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac aaggctgacctggaccagtcgagagtgatctccagagaggaggcccagggctttgccaga gagaacaggatccattacatggaggcctcggctaagaaccgccacaatgtagacgaagcc ttcctggaggtcgtgcgagctataagaaagtttcaggagactgagagtccccctctacct gcaaaccacacaggaaaacggaaaagcggtggctgcccctgcaccctcctttaa

DBGET integrated database retrieval system