Salvelinus fontinalis (brook trout): 129831415 Help Entry 129831415         CDS       T11136                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism sfon  Salvelinus fontinalis (brook trout) Pathway sfon04382   Cornified envelope formation sfon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfon00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     129831415  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129831415  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfon04147]     129831415 Exosome [BR:sfon04147]  Exosomal proteins   Exosomal proteins of microglial cells    129831415 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_FSTL1 EF-hand_8 DAXX_hist_bd Bcl-2 NNH2 DEK_C WHD_plant_repro EH Motif Other DBs NCBI-GeneID:  129831415 NCBI-ProteinID:  XP_055750767 LinkDB All DBs Position 32:complement(43506924..43508853) Genome browser AA seq 99 aa AA seqDB search MPSELERAMESMITVFHKYAAKEGNGNTLSRRELRDLMENELSGFLKSQKDPATVDKIMK DLDSNGDGEVNFEEFVSLVVGLSIACEQCYQMHKKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccatcagaactggaacgcgcaatggagtccatgatcactgtgttccacaagtatgct gctaaggagggcaatggcaacactctgagccgccgtgagctaagggacctgatggagaac gagctctctggcttcctcaagtctcagaaggacccagccacagtagacaagatcatgaag gatctggactctaatggtgatggagaggtgaactttgaggagtttgtttctctcgttgtg ggcctgtccatcgcctgtgaacagtgctaccagatgcacaagaagaagatggggaagtga

DBGET integrated database retrieval system