Salvelinus fontinalis (brook trout): 129833584 Help Entry 129833584         CDS       T11136                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism sfon  Salvelinus fontinalis (brook trout) Pathway sfon04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sfon00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     129833584  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sfon04121]     129833584    03400 DNA repair and recombination proteins [BR:sfon03400]     129833584 Ubiquitin system [BR:sfon04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      129833584    Cul5 complex      129833584 DNA repair and recombination proteins [BR:sfon03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      129833584 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  129833584 NCBI-ProteinID:  XP_055754254 LinkDB All DBs Position 34:25006108..25010269 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRLGDDAFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatccggcgtcacaagacaaccatcttcactgatgccaaagag tcaactacggtctacgagctgaagcgcatagtggagggtatcctaaagagggcaccggag gaacagaggctgtacaaggatgacatgttgctggaggatagtaagactcttggagactgt ggtttcacaaatcagacagccagacctcaggccccagggactgttggattagcattccgt cttggtgatgatgcatttgagcagctgagggttgagcccttctccagccccccagagctt cctgacgtcatgaagcctcaggactctggcagcacagccaatgagcaggccgtgcagtga

DBGET integrated database retrieval system