Salvelinus fontinalis (brook trout): 129853498 Help Entry 129853498         CDS       T11136                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism sfon  Salvelinus fontinalis (brook trout) Pathway sfon04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sfon00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     129853498  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sfon04121]     129853498    03400 DNA repair and recombination proteins [BR:sfon03400]     129853498 Ubiquitin system [BR:sfon04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      129853498    Cul5 complex      129853498 DNA repair and recombination proteins [BR:sfon03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      129853498 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  129853498 NCBI-ProteinID:  XP_055775625 LinkDB All DBs Position 1:complement(41549883..41552029) Genome browser AA seq 114 aa AA seqDB search MIQRQKTTIFTDAKESTTVYELKRIVEGILKREPEEQRLFKDDQLLENSKTLGDCGFTNQ TARPQAPGTVGLAFRMGDELFEQLQVEAFSSPPELPDVMKPQDSGSTANEQTVQ NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgatccagcgtcagaagaccaccattttcacagacgccaaagagtccaccaccgtctac gagctgaagcgcattgtcgagggaattctcaagagagagcctgaggaacagaggcttttc aaggatgaccagttgctagaaaacagtaaaactcttggcgattgcggcttcaccaaccag actgcaagacctcaggccccaggcactgttggactggctttccgaatgggtgatgagttg tttgagcagctgcaggtggaggcattctccagccctccagagctccctgacgtcatgaag ccccaagactctggcagcactgccaacgaacagactgtgcagtga

DBGET integrated database retrieval system