Salvelinus fontinalis (brook trout): 129862194 Help Entry 129862194         CDS       T11136                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism sfon  Salvelinus fontinalis (brook trout) Pathway sfon04010   MAPK signaling pathway sfon04012   ErbB signaling pathway sfon04068   FoxO signaling pathway sfon04137   Mitophagy - animal sfon04140   Autophagy - animal sfon04144   Endocytosis sfon04150   mTOR signaling pathway sfon04210   Apoptosis sfon04218   Cellular senescence sfon04370   VEGF signaling pathway sfon04371   Apelin signaling pathway sfon04510   Focal adhesion sfon04540   Gap junction sfon04625   C-type lectin receptor signaling pathway sfon04810   Regulation of actin cytoskeleton sfon04910   Insulin signaling pathway sfon04912   GnRH signaling pathway sfon04916   Melanogenesis sfon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129862194    04012 ErbB signaling pathway     129862194    04370 VEGF signaling pathway     129862194    04371 Apelin signaling pathway     129862194    04068 FoxO signaling pathway     129862194    04150 mTOR signaling pathway     129862194  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129862194    04140 Autophagy - animal     129862194    04137 Mitophagy - animal     129862194   09143 Cell growth and death    04210 Apoptosis     129862194    04218 Cellular senescence     129862194   09144 Cellular community - eukaryotes    04510 Focal adhesion     129862194    04540 Gap junction     129862194   09142 Cell motility    04810 Regulation of actin cytoskeleton     129862194  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129862194   09152 Endocrine system    04910 Insulin signaling pathway     129862194    04912 GnRH signaling pathway     129862194    04916 Melanogenesis     129862194  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129862194  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfon04131]     129862194   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfon04147]     129862194    04031 GTP-binding proteins [BR:sfon04031]     129862194 Membrane trafficking [BR:sfon04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     129862194  Endocytosis   Macropinocytosis    Ras GTPases     129862194 Exosome [BR:sfon04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    129862194   Exosomal proteins of colorectal cancer cells    129862194 GTP-binding proteins [BR:sfon04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129862194 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin AAA_16 Motif Other DBs NCBI-GeneID:  129862194 NCBI-ProteinID:  XP_055789587 LinkDB All DBs Position 9:18237160..18264121 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtggtggtgggggctggaggtgtggggaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatacgaccccaccatagaggactcatac aggaagcaggtggtgattgatggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgctatgagggaccaatacatgaggacaggggagggcttcctctgt gttttcgccatcaacaacaccaagtccttcgaggacattcaccagtacagggaacagatc aaacgtgtgaaagactctgacgacgtgcccatggtcctggtgggtaataaatgtgacctc ccatcgcgtactgtggacacgcggcaagcacaggaattggcccgcagctacggaattccc tacatcgagacctctgccaagacacgacagggggtagaggacgccttctacacgctagtg agagagatcaggcagcacaagctgaggaagctcaaccctccggatgagagtggacaggac tgcatgagctgccgctgtgtggtgtcgtga

DBGET integrated database retrieval system