Streptomyces flavofungini: QUY26_28020 Help Entry QUY26_28020       CDS       T09698                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfp  Streptomyces flavofungini Pathway sfp00998   Biosynthesis of various antibiotics sfp01100   Metabolic pathways sfp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QUY26_28020    00074 Mycolic acid biosynthesis     QUY26_28020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QUY26_28020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WJV49022 LinkDB All DBs Position complement(6570148..6570396) Genome browser AA seq 82 aa AA seqDB search MAATEKEIVDGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATKYILEHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactgagaaggagatcgtcgacggtctcgcggagatcgtcaacgagatcgcc ggcatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctgaagaccgtcggcgacgcgacgaagtacatcctcgagcac caggcctga

DBGET integrated database retrieval system