Shewanella frigidimarina: Sfri_1144 Help Entry Sfri_1144         CDS       T00395                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism sfr  Shewanella frigidimarina Pathway sfr00190   Oxidative phosphorylation sfr01100   Metabolic pathways sfr02020   Two-component system Module sfr_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:sfr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Sfri_1144  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Sfri_1144 Enzymes [BR:sfr01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Sfri_1144 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABI70997 UniProt:  Q085R8 LinkDB All DBs Position 1351127..1351237 Genome browser AA seq 36 aa AA seqDB search MWYFAWILGVLLACSFGIINALWLENTENMDRNNEL NT seq 111 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcgtggattttaggggtattgttagcgtgttcattcggtatcatcaac gcgttatggcttgagaatactgaaaatatggatcgtaacaacgaactataa

DBGET integrated database retrieval system