Stenomitos frigidus: RBJ76_08415 Help Entry RBJ76_08415       CDS       T10829                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sfri  Stenomitos frigidus Pathway sfri00190   Oxidative phosphorylation sfri00195   Photosynthesis sfri01100   Metabolic pathways Module sfri_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sfri00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RBJ76_08415 (atpE)    00195 Photosynthesis     RBJ76_08415 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sfri00194]     RBJ76_08415 (atpE) Photosynthesis proteins [BR:sfri00194]  Photosystem and electron transport system   F-type ATPase [OT]    RBJ76_08415 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  XHX79930 LinkDB All DBs Position 1772944..1773189 Genome browser AA seq 81 aa AA seqDB search MDPLVQAASVFSAALAIGLASIGPGIGQGNASGSAVEGIARQPEAEGKIRGTLLLTLAFM ESLTIYGLVIALVLLFANPFA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggatccattagttcaagctgcgtctgtcttttctgctgcactagcgatcggtctagcg tctattggtcctggtattggtcagggtaatgcgtccggttctgctgttgaagggattgct cgtcaaccagaagcagaaggcaaaattcgcggtacgcttttgctaacgctggcgtttatg gaatccttgaccatctatggcttggtcatcgctctcgtgctgttgtttgccaatcccttt gcttaa

DBGET integrated database retrieval system