Stenomitos frigidus: RBJ76_24030 Help Entry RBJ76_24030       CDS       T10829                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfri  Stenomitos frigidus Pathway sfri01100   Metabolic pathways sfri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RBJ76_24030 (acpP)    00074 Mycolic acid biosynthesis     RBJ76_24030 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RBJ76_24030 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF6137 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XHX77473 LinkDB All DBs Position complement(5118375..5118629) Genome browser AA seq 84 aa AA seqDB search MTTETEIFEKVQKIVAEQLGVEVSEVKPEASFANDLGADSLDTVELVMALEEEFDIEIPD EAAEEIATVKSAVDYINTKVSASA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccaccgagacagaaatttttgagaaagtccagaagattgtagctgaacagctaggc gttgaagtcagtgaagtcaagccagaagccagctttgccaacgatctgggagccgattcc ctcgataccgttgagttggtcatggcgctggaagaagaattcgatatcgaaattcctgac gaagcggcagaagagattgcaactgtgaagtctgctgtagactacatcaacaccaaagtg tcagcatcagcttaa

DBGET integrated database retrieval system