Syntrophobacter fumaroxidans: Sfum_3460 Help Entry Sfum_3460         CDS       T00418                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfu  Syntrophobacter fumaroxidans Pathway sfu01100   Metabolic pathways sfu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sfum_3460    00074 Mycolic acid biosynthesis     Sfum_3460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sfum_3460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  ABK19131 UniProt:  A0LNX9 LinkDB All DBs Position 4226917..4227162 Genome browser AA seq 81 aa AA seqDB search MDVAAMQVKIVDIIANQLGVDKEIITPEANVVDDLGADSLDVVELVMALEEAFDVEIPDE DAESIRTVKDIFDYLAKNKAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggatgtagctgcaatgcaggtcaagatcgttgacatcatcgcaaaccaactgggcgtc gacaaggaaatcatcactcctgaggccaacgtggtggacgatctgggcgccgattcgctg gacgtggtcgagctggtcatggcgctggaagaagctttcgatgtcgagattcccgacgag gatgccgagagcattcgcaccgtgaaggatattttcgattacctggcgaagaacaaggcg gcttga

DBGET integrated database retrieval system