KEGG   Streptomyces fungicidicus: CNQ36_22800
Entry
CNQ36_22800       CDS       T07133                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
sfug  Streptomyces fungicidicus
Pathway
sfug01057  Biosynthesis of type II polyketide products
sfug01100  Metabolic pathways
sfug01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfug00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CNQ36_22800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sfug01008]
    CNQ36_22800
Polyketide biosynthesis proteins [BR:sfug01008]
 Polyketide tailoring proteins
  Others
   CNQ36_22800
SSDB
Other DBs
NCBI-ProteinID: AYL39638
UniProt: A0A494V985
LinkDB
Position
4979085..4980074
AA seq 329 aa
MTLTCASLFASNAAFAERGSNGNANEAEQSANADDKGNLSVTVGGIVFDRSKNGSGGSAG
ALTSSTSWSPPACWYAPKYTPEQLQKYLEPIWEAGSTGYEWDAEQREKYNADDEKKAFNK
DKSGEGFWWGSYVNKSYPPGWDACTEDYFWVDTGDAPPADIENAITPEILAGLAYAEIRV
PGTEVTLAPTETTKVNLPTWAWLDGAEFKPVSVTASVPDIAISATATAEPVSLEIKPGTP
DAQTYPASGVCGIDGRRIGEPYQKGDADRTPPCGVKYLRSSGDGAFPLQATVTWKIHWTG
TGGAEGNLPDGEFGATQDVVVQEIQAINR
NT seq 990 nt   +upstreamnt  +downstreamnt
ctgacactcacgtgcgcttcactcttcgcctcgaacgcggcttttgccgagcgtggctcg
aacgggaacgccaacgaggcggaacagagcgccaacgccgacgacaagggcaacctctcc
gtcaccgtcggcggcatcgtcttcgatcgttcgaagaacgggagtggcgggtccgccggg
gcgctgacgtcgtccacgtcatggagccccccggcctgctggtacgcccccaagtacacc
cccgagcagttgcagaagtatctggagccgatctgggaggccggctcgacggggtacgag
tgggacgccgagcagcgggagaagtacaacgccgacgacgagaagaaggccttcaacaag
gacaagtccggcgagggcttctggtggggctcgtacgtcaacaagagctacccgccgggc
tgggacgcctgcacagaggactacttctgggtggacaccggcgacgcaccgcccgccgac
atcgagaacgccatcaccccggagatcctcgccggactcgcctacgcggagatccgcgtc
ccgggcaccgaggtgacgctggcccccacggagacgaccaaggtcaacctgcccacctgg
gcatggctcgacggcgccgagttcaagccggtctccgtcaccgcgtccgtgccggacatc
gccatctcggcgacggccacggcggaaccggtctcgctggagatcaagccgggcactccg
gacgcccagacctacccggcctccggcgtctgcgggatcgacggccggcggatcggcgag
ccgtaccaaaagggcgacgcggaccggacaccgccgtgcggcgtgaagtacctgcgctcc
tccggcgacggcgcgttcccgctgcaggcgacggtcacctggaagatccactggaccggc
accggcggcgcggaaggcaatcttcccgacggcgagttcggcgccacgcaggacgtcgtc
gtccaggagatccaggccatcaaccgctga

DBGET integrated database retrieval system