KEGG   Streptomyces fungicidicus: CNQ36_28060
Entry
CNQ36_28060       CDS       T07133                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
sfug  Streptomyces fungicidicus
Pathway
sfug00770  Pantothenate and CoA biosynthesis
sfug01100  Metabolic pathways
sfug01240  Biosynthesis of cofactors
Module
sfug_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sfug00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CNQ36_28060
Enzymes [BR:sfug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     CNQ36_28060
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig HcgB
Other DBs
NCBI-ProteinID: AYL38916
UniProt: A0A494V2C6
LinkDB
Position
6240329..6240808
AA seq 159 aa
MRRAVCPGSFDPITNGHLDIIARASRLYDEVYVAVMINQSKKGLFEIEERIDLIRRVTAE
YGNVRVEAFHGLLVDFCKQRDIPAIVKGLRAVSDFDYELQMAQMNNGLSGVETLFVPTNP
TYSFLSSSLVKEVATWGGDVAHLVPPEVLTALTERLRKD
NT seq 480 nt   +upstreamnt  +downstreamnt
gtgcgtcgcgccgtatgccccgggtcgttcgacccgatcaccaacggacacctcgacatc
atcgcccgggcctcccggctgtacgacgaggtctacgtcgcggtgatgatcaaccagtcc
aagaaggggctgttcgagatcgaggagcggatcgacctgatccgccgggtcaccgccgag
tacggcaacgtccgcgtcgaggccttccacggcctgctcgtcgacttctgcaagcagcgc
gacatccccgccatcgtcaagggcctgcgcgcggtcagcgacttcgactacgagctgcag
atggcccagatgaacaacggcctctcgggcgtggagaccctcttcgtccccaccaacccc
acctacagcttcctgtcctcctcgctcgtcaaggaggtcgcgacctggggcggcgacgtc
gcccacctggtgccgccggaggtcctgacggccctcaccgagcggctgcgcaaggactga

DBGET integrated database retrieval system