Sorex fumeus (smoky shrew): 130015763 Help Entry 130015763         CDS       T10594                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum01521   EGFR tyrosine kinase inhibitor resistance sfum01522   Endocrine resistance sfum04010   MAPK signaling pathway sfum04012   ErbB signaling pathway sfum04014   Ras signaling pathway sfum04015   Rap1 signaling pathway sfum04062   Chemokine signaling pathway sfum04068   FoxO signaling pathway sfum04071   Sphingolipid signaling pathway sfum04072   Phospholipase D signaling pathway sfum04137   Mitophagy - animal sfum04140   Autophagy - animal sfum04150   mTOR signaling pathway sfum04151   PI3K-Akt signaling pathway sfum04210   Apoptosis sfum04211   Longevity regulating pathway sfum04213   Longevity regulating pathway - multiple species sfum04218   Cellular senescence sfum04360   Axon guidance sfum04370   VEGF signaling pathway sfum04371   Apelin signaling pathway sfum04540   Gap junction sfum04550   Signaling pathways regulating pluripotency of stem cells sfum04625   C-type lectin receptor signaling pathway sfum04650   Natural killer cell mediated cytotoxicity sfum04660   T cell receptor signaling pathway sfum04662   B cell receptor signaling pathway sfum04664   Fc epsilon RI signaling pathway sfum04714   Thermogenesis sfum04720   Long-term potentiation sfum04722   Neurotrophin signaling pathway sfum04725   Cholinergic synapse sfum04726   Serotonergic synapse sfum04730   Long-term depression sfum04810   Regulation of actin cytoskeleton sfum04910   Insulin signaling pathway sfum04912   GnRH signaling pathway sfum04915   Estrogen signaling pathway sfum04916   Melanogenesis sfum04917   Prolactin signaling pathway sfum04919   Thyroid hormone signaling pathway sfum04921   Oxytocin signaling pathway sfum04926   Relaxin signaling pathway sfum04929   GnRH secretion sfum04933   AGE-RAGE signaling pathway in diabetic complications sfum04935   Growth hormone synthesis, secretion and action sfum05010   Alzheimer disease sfum05022   Pathways of neurodegeneration - multiple diseases sfum05034   Alcoholism sfum05160   Hepatitis C sfum05161   Hepatitis B sfum05163   Human cytomegalovirus infection sfum05165   Human papillomavirus infection sfum05166   Human T-cell leukemia virus 1 infection sfum05167   Kaposi sarcoma-associated herpesvirus infection sfum05170   Human immunodeficiency virus 1 infection sfum05200   Pathways in cancer sfum05203   Viral carcinogenesis sfum05205   Proteoglycans in cancer sfum05206   MicroRNAs in cancer sfum05207   Chemical carcinogenesis - receptor activation sfum05208   Chemical carcinogenesis - reactive oxygen species sfum05210   Colorectal cancer sfum05211   Renal cell carcinoma sfum05213   Endometrial cancer sfum05214   Glioma sfum05215   Prostate cancer sfum05216   Thyroid cancer sfum05218   Melanoma sfum05219   Bladder cancer sfum05220   Chronic myeloid leukemia sfum05221   Acute myeloid leukemia sfum05223   Non-small cell lung cancer sfum05224   Breast cancer sfum05225   Hepatocellular carcinoma sfum05226   Gastric cancer sfum05230   Central carbon metabolism in cancer sfum05231   Choline metabolism in cancer sfum05235   PD-L1 expression and PD-1 checkpoint pathway in cancer sfum05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130015763 (NRAS)    04012 ErbB signaling pathway     130015763 (NRAS)    04014 Ras signaling pathway     130015763 (NRAS)    04015 Rap1 signaling pathway     130015763 (NRAS)    04370 VEGF signaling pathway     130015763 (NRAS)    04371 Apelin signaling pathway     130015763 (NRAS)    04068 FoxO signaling pathway     130015763 (NRAS)    04072 Phospholipase D signaling pathway     130015763 (NRAS)    04071 Sphingolipid signaling pathway     130015763 (NRAS)    04151 PI3K-Akt signaling pathway     130015763 (NRAS)    04150 mTOR signaling pathway     130015763 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130015763 (NRAS)    04137 Mitophagy - animal     130015763 (NRAS)   09143 Cell growth and death    04210 Apoptosis     130015763 (NRAS)    04218 Cellular senescence     130015763 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     130015763 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     130015763 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130015763 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130015763 (NRAS)    04650 Natural killer cell mediated cytotoxicity     130015763 (NRAS)    04660 T cell receptor signaling pathway     130015763 (NRAS)    04662 B cell receptor signaling pathway     130015763 (NRAS)    04664 Fc epsilon RI signaling pathway     130015763 (NRAS)    04062 Chemokine signaling pathway     130015763 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     130015763 (NRAS)    04929 GnRH secretion     130015763 (NRAS)    04912 GnRH signaling pathway     130015763 (NRAS)    04915 Estrogen signaling pathway     130015763 (NRAS)    04917 Prolactin signaling pathway     130015763 (NRAS)    04921 Oxytocin signaling pathway     130015763 (NRAS)    04926 Relaxin signaling pathway     130015763 (NRAS)    04935 Growth hormone synthesis, secretion and action     130015763 (NRAS)    04919 Thyroid hormone signaling pathway     130015763 (NRAS)    04916 Melanogenesis     130015763 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     130015763 (NRAS)    04726 Serotonergic synapse     130015763 (NRAS)    04720 Long-term potentiation     130015763 (NRAS)    04730 Long-term depression     130015763 (NRAS)    04722 Neurotrophin signaling pathway     130015763 (NRAS)   09158 Development and regeneration    04360 Axon guidance     130015763 (NRAS)   09149 Aging    04211 Longevity regulating pathway     130015763 (NRAS)    04213 Longevity regulating pathway - multiple species     130015763 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     130015763 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     130015763 (NRAS)    05206 MicroRNAs in cancer     130015763 (NRAS)    05205 Proteoglycans in cancer     130015763 (NRAS)    05207 Chemical carcinogenesis - receptor activation     130015763 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     130015763 (NRAS)    05203 Viral carcinogenesis     130015763 (NRAS)    05230 Central carbon metabolism in cancer     130015763 (NRAS)    05231 Choline metabolism in cancer     130015763 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     130015763 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     130015763 (NRAS)    05225 Hepatocellular carcinoma     130015763 (NRAS)    05226 Gastric cancer     130015763 (NRAS)    05214 Glioma     130015763 (NRAS)    05216 Thyroid cancer     130015763 (NRAS)    05221 Acute myeloid leukemia     130015763 (NRAS)    05220 Chronic myeloid leukemia     130015763 (NRAS)    05218 Melanoma     130015763 (NRAS)    05211 Renal cell carcinoma     130015763 (NRAS)    05219 Bladder cancer     130015763 (NRAS)    05215 Prostate cancer     130015763 (NRAS)    05213 Endometrial cancer     130015763 (NRAS)    05224 Breast cancer     130015763 (NRAS)    05223 Non-small cell lung cancer     130015763 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     130015763 (NRAS)    05170 Human immunodeficiency virus 1 infection     130015763 (NRAS)    05161 Hepatitis B     130015763 (NRAS)    05160 Hepatitis C     130015763 (NRAS)    05163 Human cytomegalovirus infection     130015763 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     130015763 (NRAS)    05165 Human papillomavirus infection     130015763 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     130015763 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     130015763 (NRAS)   09165 Substance dependence    05034 Alcoholism     130015763 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     130015763 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     130015763 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     130015763 (NRAS)    01522 Endocrine resistance     130015763 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfum04131]     130015763 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130015763 (NRAS)    04031 GTP-binding proteins [BR:sfum04031]     130015763 (NRAS) Membrane trafficking [BR:sfum04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     130015763 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     130015763 (NRAS) Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130015763 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    130015763 (NRAS)   Exosomal proteins of breast cancer cells    130015763 (NRAS)   Exosomal proteins of colorectal cancer cells    130015763 (NRAS) GTP-binding proteins [BR:sfum04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130015763 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  130015763 NCBI-ProteinID:  XP_055962505 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLSCMVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaactggtggtggtcggagcaggcggtgtcgggaaaagcgccctgacg atccagctcattcagaaccacttcgtagacgagtatgatcccaccatagaggactcttac cgaaagcaagtggttatagatggcgagacctgtctgctggacatactggacacagctgga caagaagaatacagtgccatgagagaccagtacatgcgcacaggcgaaggcttcctctgt gtatttgccatcaataacagcaagtcatttgcagatattaacctctacagggaacagatt aagcgagttaaagattcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaagaacggttgatacaaaacaagcccatgaactggccaaaagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggtc agagaaatacgccagtatcgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgtatggggttatcatgtatggtgatgtaa

DBGET integrated database retrieval system