Sorex fumeus (smoky shrew): 130016027 Help Entry 130016027         CDS       T10594                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04613   Neutrophil extracellular trap formation sfum05034   Alcoholism sfum05202   Transcriptional misregulation in cancer sfum05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sfum00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     130016027  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     130016027   09163 Immune disease    05322 Systemic lupus erythematosus     130016027   09165 Substance dependence    05034 Alcoholism     130016027  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfum03036]     130016027   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130016027 Chromosome and associated proteins [BR:sfum03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130016027 Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130016027 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  130016027 NCBI-ProteinID:  XP_055962761 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MLTAELHSLRMNLMQRAHTNPTTRKSTGGKVPRKQLATKAAHKSVPATGGNKKPHCYLPD TVVLREICRYQKSTELLIHKLPFQLLVHEITQDFKTDLHSQSLAIMALQEACEAYLMGLF EDTNFCIIHTKCVTIMPKDIQLVCRIRRERA NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgctcacagctgaactccacagtctccggatgaacctcatgcagagggctcatactaat ccgacgacacgcaagtcaacaggtgggaaggtgccccgcaagcagctggccaccaaggca gcccacaagagcgtgccagccacgggaggtaataagaagcctcactgctacctgcccgac accgtggtgcttcgtgagatctgccgctaccagaagtccaccgagctgcttatccacaag ctgccattccagctgctggtgcacgagatcacgcaggacttcaagactgacctgcactcc cagagcttggcaatcatggcactgcaggaggcttgtgaagcctatctgatggggctcttc gaggacaccaacttttgcatcatccacaccaagtgtgtcaccattatgcccaaagacatc cagctggtgtgccgcatccgcagagagagggcttaa

DBGET integrated database retrieval system