Sorex fumeus (smoky shrew): 130016791 Help Entry 130016791         CDS       T10594                                  Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum03082   ATP-dependent chromatin remodeling sfum04217   Necroptosis sfum04613   Neutrophil extracellular trap formation sfum05034   Alcoholism sfum05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sfum00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     130016791  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     130016791  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     130016791  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     130016791   09165 Substance dependence    05034 Alcoholism     130016791  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfum03036]     130016791   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130016791 Chromosome and associated proteins [BR:sfum03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130016791 Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130016791 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  130016791 NCBI-ProteinID:  XP_055963463 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPAGGKKASQASQEY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccgcggcaagaccggcggcaaggcccgcgccaaggccaagtcgcgctcgtcg cgcgccggcctccagttcccggtcggccgggtgcaccggctgctgcggaagggccactac gccgagcgggtgggcgccggcgcgccggtctacctggccgcggtgctcgagtacctcacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgacgatcgctcaggggggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acgagcgccaccgtggggccgaaggcgcccgccggcggcaagaaggcctcgcaggcctcg caggagtactga

DBGET integrated database retrieval system