Sorex fumeus (smoky shrew): 130018121 Help Entry 130018121         CDS       T10594                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04613   Neutrophil extracellular trap formation sfum05034   Alcoholism sfum05202   Transcriptional misregulation in cancer sfum05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sfum00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     130018121  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     130018121   09163 Immune disease    05322 Systemic lupus erythematosus     130018121   09165 Substance dependence    05034 Alcoholism     130018121  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfum03036]     130018121   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130018121 Chromosome and associated proteins [BR:sfum03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130018121 Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130018121 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone DUF4808 Motif Other DBs NCBI-GeneID:  130018121 NCBI-ProteinID:  XP_055964921 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MDLIYLTQNESPAELGRRRRLVLSRQCARQQAGRNPASSWPTRQPARVHRRSLTTTCSTQ WSYLTTSSCSSSDSCARSRRNSRLTCDSQNSAVMVLQEVCKAYLVGLLEDTNLCPFPANR LTSMPKDIQLACHICGERV NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggatctcatttatctaacccagaatgagtctccagctgagttgggaagaaggagaagg ctcgtactaagcagacagtgtgcacgtcaacaggcaggaaggaaccctgcaagcagctgg ccaacaaggcagcctgcaagagtgcaccgaagaagcctcaccacgacctgctccacacag tggagctacctgacaacctccagctgcagttccagtgactcgtgtgcgagatcacgcagg aattcaagactgacctgtgattcccagaactcagctgtcatggtgctgcaggaggtttgc aaggcctacctggtggggctcttggaggacaccaacctctgcccatttcctgccaatcgc ctcactagtatgcccaaggacatccagctggcgtgccacatctgcggggagagagtataa

DBGET integrated database retrieval system