Sorex fumeus (smoky shrew): 130018531 Help Entry 130018531         CDS       T10594                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04146   Peroxisome sfum04213   Longevity regulating pathway - multiple species sfum05012   Parkinson disease sfum05014   Amyotrophic lateral sclerosis sfum05016   Huntington disease sfum05020   Prion disease sfum05022   Pathways of neurodegeneration - multiple diseases sfum05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:sfum00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     130018531 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     130018531 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     130018531 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     130018531 (SOD1)    05014 Amyotrophic lateral sclerosis     130018531 (SOD1)    05016 Huntington disease     130018531 (SOD1)    05020 Prion disease     130018531 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     130018531 (SOD1) Enzymes [BR:sfum01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      130018531 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  130018531 NCBI-ProteinID:  XP_055965235 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MATKAVCVLKGDGPVKGTIRFEQQGNGPVKVSGSISGLTEGQHGFHVHQFGDNTQGCTSA GPHFNPFAKKHGGPQDQERHVGDLGNVTAGKDGVATVDIQDTMITLCGDHSIIGRTMVVH EKEDDLGKGGNEESTKTGNAGGRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaaggccgtgtgcgtgctgaagggcgacggcccggtgaagggcaccatccgc ttcgaacagcaggggaacgggcccgtgaaggtgtcggggtccatttccggacttactgaa ggccagcacggattccatgtgcatcagttcggagataacacgcaaggttgtaccagtgca ggccctcactttaatccttttgccaaaaagcatggtgggccacaggaccaagagagacat gttggagacctggggaatgtgactgcaggcaaagatggtgtagccaccgtggatattcag gacaccatgatcactctctgcggagatcattccatcattggccgcaccatggtggtccat gaaaaagaagatgacttgggcaaaggtggaaatgaagaaagtacaaagacaggaaatgct ggaggtcgcttggcttgtggtgtcatcggaatcgcccagtaa

DBGET integrated database retrieval system