Sorex fumeus (smoky shrew): 130022461 Help Entry 130022461         CDS       T10594                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04015   Rap1 signaling pathway sfum04810   Regulation of actin cytoskeleton sfum05014   Amyotrophic lateral sclerosis sfum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     130022461 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     130022461 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130022461 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     130022461 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfum04131]     130022461 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:sfum04812]     130022461 (PFN3)    04147 Exosome [BR:sfum04147]     130022461 (PFN3) Membrane trafficking [BR:sfum04131]  Others   Actin-binding proteins    Others     130022461 (PFN3) Cytoskeleton proteins [BR:sfum04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      130022461 (PFN3) Exosome [BR:sfum04147]  Exosomal proteins   Proteins found in most exosomes    130022461 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  130022461 NCBI-ProteinID:  XP_055969209 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYICAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRSFL QTGVSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGCRGVHGGV LNKTVHELIHGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggttacatctgtgcggtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcctcgcggcccgggggcctgctg gcggccatctccccgcaggaggtcggggtgctcacgggacctgaccggcgcagcttcctg cagacgggcgtgagcgtggcggggcgccgctgctgcgtcatccgcgaccatctgctggcc gagggcgacggcgtgctggacgcgcgcaccaaggggctggacgggcgcgctgtgtgcgtg ggccacacgccgcgcgtgctgctggtgctcatgggctgccgtggcgtgcacggcggcgtc ctgaacaagacggtgcacgagctcatccacgggctgcgcacgcagggaacctag

DBGET integrated database retrieval system