Sorex fumeus (smoky shrew): 130023729 Help Entry 130023729         CDS       T10594                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04060   Cytokine-cytokine receptor interaction sfum04620   Toll-like receptor signaling pathway sfum04622   RIG-I-like receptor signaling pathway sfum04625   C-type lectin receptor signaling pathway sfum04630   JAK-STAT signaling pathway sfum04658   Th1 and Th2 cell differentiation sfum04936   Alcoholic liver disease sfum04940   Type I diabetes mellitus sfum05133   Pertussis sfum05134   Legionellosis sfum05140   Leishmaniasis sfum05142   Chagas disease sfum05143   African trypanosomiasis sfum05144   Malaria sfum05145   Toxoplasmosis sfum05146   Amoebiasis sfum05152   Tuberculosis sfum05162   Measles sfum05164   Influenza A sfum05168   Herpes simplex virus 1 infection sfum05171   Coronavirus disease - COVID-19 sfum05200   Pathways in cancer sfum05321   Inflammatory bowel disease sfum05330   Allograft rejection sfum05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     130023729 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     130023729 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130023729 (IL12A)    04622 RIG-I-like receptor signaling pathway     130023729 (IL12A)    04625 C-type lectin receptor signaling pathway     130023729 (IL12A)    04658 Th1 and Th2 cell differentiation     130023729 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     130023729 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     130023729 (IL12A)    05164 Influenza A     130023729 (IL12A)    05162 Measles     130023729 (IL12A)    05168 Herpes simplex virus 1 infection     130023729 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     130023729 (IL12A)    05134 Legionellosis     130023729 (IL12A)    05152 Tuberculosis     130023729 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     130023729 (IL12A)    05144 Malaria     130023729 (IL12A)    05145 Toxoplasmosis     130023729 (IL12A)    05140 Leishmaniasis     130023729 (IL12A)    05142 Chagas disease     130023729 (IL12A)    05143 African trypanosomiasis     130023729 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     130023729 (IL12A)    05330 Allograft rejection     130023729 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     130023729 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     130023729 (IL12A)    04936 Alcoholic liver disease     130023729 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfum04052]     130023729 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:sfum00536]     130023729 (IL12A) Cytokines and neuropeptides [BR:sfum04052]  Cytokines   Interleukins    130023729 (IL12A) Glycosaminoglycan binding proteins [BR:sfum00536]  Heparan sulfate / Heparin   Cytokines    130023729 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  130023729 NCBI-ProteinID:  XP_055970294 LinkDB All DBs Position Unknown AA seq 232 aa AA seqDB search MHPRSLLLLVATLVLLSPQDLLGLARSLPVTPKDGPAVTERLSRAQNLLEAVMASLQTAR HTLSLYPCSPEETDHVDITREKTSTVQTCVPWELAAVWSPTRRQSDLRRLSGTGFRQTRN SICLPWEKDPLRMRALCLGNISKDLELYQLEFRTLNAKLLMDPQQQISVDQNLLGAIEGL MQALTLTGESEPEAPAVGEPDLYRAKVQLCVLLQAFHVRAVTIHRVMSHLAA NT seq 699 nt NT seq  +upstreamnt  +downstreamnt atgcacccccggagccttctcctcctcgtggccaccctggtcctcctaagcccccaagac ctcctcgggctggccaggagcctcccagtgacccccaaggacggcccagcagtgaccgag cgtctcagccgggcccagaacctgctggaggcagtcatggcctctttgcagacggccaga cacaccctgtcactttacccctgctctcccgaggagactgaccacgtggacatcacgagg gagaagaccagcaccgtccagacctgcgtgccctgggagctagccgcggtatggagcccc acacggcgccagtcagacttgaggcggctcagcgggacaggcttccgacagacccgcaac agtatctgcctgccctgggagaaggacccccttagaatgcgcgccctctgcctggggaac atctccaaggacctggagctgtaccagctggagttcaggaccttgaatgcgaagctgctg atggacccgcagcagcagatctcagtggaccagaacctgctgggagcgatcgaggggctg atgcaggccctgaccttgacaggggagtcggagcctgaagccccggccgtgggagaaccg gatttgtaccgagccaaggtgcagctctgcgtcctgctccaggccttccacgtccgcgca gtgaccatccacagggtgatgtcccacctggccgcctag

DBGET integrated database retrieval system