KEGG   Sorex fumeus (smoky shrew): 130024040
Entry
130024040         CDS       T10594                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
sfum  Sorex fumeus (smoky shrew)
Pathway
sfum04014  Ras signaling pathway
sfum04015  Rap1 signaling pathway
sfum04020  Calcium signaling pathway
sfum04022  cGMP-PKG signaling pathway
sfum04024  cAMP signaling pathway
sfum04070  Phosphatidylinositol signaling system
sfum04114  Oocyte meiosis
sfum04218  Cellular senescence
sfum04261  Adrenergic signaling in cardiomyocytes
sfum04270  Vascular smooth muscle contraction
sfum04371  Apelin signaling pathway
sfum04625  C-type lectin receptor signaling pathway
sfum04713  Circadian entrainment
sfum04720  Long-term potentiation
sfum04722  Neurotrophin signaling pathway
sfum04728  Dopaminergic synapse
sfum04740  Olfactory transduction
sfum04744  Phototransduction
sfum04750  Inflammatory mediator regulation of TRP channels
sfum04910  Insulin signaling pathway
sfum04912  GnRH signaling pathway
sfum04915  Estrogen signaling pathway
sfum04916  Melanogenesis
sfum04921  Oxytocin signaling pathway
sfum04922  Glucagon signaling pathway
sfum04924  Renin secretion
sfum04925  Aldosterone synthesis and secretion
sfum04970  Salivary secretion
sfum04971  Gastric acid secretion
sfum05010  Alzheimer disease
sfum05012  Parkinson disease
sfum05022  Pathways of neurodegeneration - multiple diseases
sfum05031  Amphetamine addiction
sfum05034  Alcoholism
sfum05133  Pertussis
sfum05152  Tuberculosis
sfum05163  Human cytomegalovirus infection
sfum05167  Kaposi sarcoma-associated herpesvirus infection
sfum05170  Human immunodeficiency virus 1 infection
sfum05200  Pathways in cancer
sfum05214  Glioma
sfum05417  Lipid and atherosclerosis
sfum05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sfum00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    130024040
   04015 Rap1 signaling pathway
    130024040
   04371 Apelin signaling pathway
    130024040
   04020 Calcium signaling pathway
    130024040
   04070 Phosphatidylinositol signaling system
    130024040
   04024 cAMP signaling pathway
    130024040
   04022 cGMP-PKG signaling pathway
    130024040
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    130024040
   04218 Cellular senescence
    130024040
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    130024040
  09152 Endocrine system
   04910 Insulin signaling pathway
    130024040
   04922 Glucagon signaling pathway
    130024040
   04912 GnRH signaling pathway
    130024040
   04915 Estrogen signaling pathway
    130024040
   04921 Oxytocin signaling pathway
    130024040
   04916 Melanogenesis
    130024040
   04924 Renin secretion
    130024040
   04925 Aldosterone synthesis and secretion
    130024040
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    130024040
   04270 Vascular smooth muscle contraction
    130024040
  09154 Digestive system
   04970 Salivary secretion
    130024040
   04971 Gastric acid secretion
    130024040
  09156 Nervous system
   04728 Dopaminergic synapse
    130024040
   04720 Long-term potentiation
    130024040
   04722 Neurotrophin signaling pathway
    130024040
  09157 Sensory system
   04744 Phototransduction
    130024040
   04740 Olfactory transduction
    130024040
   04750 Inflammatory mediator regulation of TRP channels
    130024040
  09159 Environmental adaptation
   04713 Circadian entrainment
    130024040
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    130024040
  09162 Cancer: specific types
   05214 Glioma
    130024040
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    130024040
   05163 Human cytomegalovirus infection
    130024040
   05167 Kaposi sarcoma-associated herpesvirus infection
    130024040
  09171 Infectious disease: bacterial
   05133 Pertussis
    130024040
   05152 Tuberculosis
    130024040
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    130024040
   05012 Parkinson disease
    130024040
   05022 Pathways of neurodegeneration - multiple diseases
    130024040
  09165 Substance dependence
   05031 Amphetamine addiction
    130024040
   05034 Alcoholism
    130024040
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    130024040
   05418 Fluid shear stress and atherosclerosis
    130024040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sfum01009]
    130024040
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfum04131]
    130024040
   03036 Chromosome and associated proteins [BR:sfum03036]
    130024040
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfum04147]
    130024040
Protein phosphatases and associated proteins [BR:sfum01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     130024040
Membrane trafficking [BR:sfum04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    130024040
Chromosome and associated proteins [BR:sfum03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     130024040
Exosome [BR:sfum04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   130024040
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 UPF0154 EH SPARC_Ca_bdg MTIP_N TerB MCM4_WHD Dockerin_1 EFhand_Ca_insen DUF5580_M EF-hand_11 Caleosin
Other DBs
NCBI-GeneID: 130024040
NCBI-ProteinID: XP_055970639
LinkDB
Position
Unknown
AA seq 149 aa
MADKLSEEKVAEFKEAFSLFDKDGDGCISTQELGTVMRSLGRNPSEAELQGLMRELDRDG
SGSVDFAEFLAVMARHSGPRCSEEEIREAFRVFDKDGSGKVSAAELRHVMTRLGETLSEQ
EVDEMIREADKDGDGQVDYEEFVRMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgacaagctgagcgaggagaaggtggccgagttcaaagaggccttctcgctgttc
gacaaggacggcgacggctgcatcagcacgcaggagctgggcaccgtcatgcgctcgctc
ggccgcaaccccagcgaggccgagctgcagggtctgatgcgcgagctggaccgcgacggc
agcggcagcgtggacttcgccgagttcctggccgtgatggcccggcacagcgggccccgc
tgcagcgaggaggagatccgcgaggccttccgcgtcttcgacaaggatggcagtggcaag
gtgagcgccgctgagctgcgccacgtcatgacgcgcctcggggagacgctgagcgagcag
gaggtggacgagatgatccgcgaggccgacaaggacggggacgggcaggtggactacgag
gagttcgtgcgcatgctggtgtccaagtga

DBGET integrated database retrieval system