Sorex fumeus (smoky shrew): 130026513 Help Entry 130026513         CDS       T10594                                  Symbol CCL21 Name (RefSeq) C-C motif chemokine 21   KO K16062   C-C motif chemokine 21 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04060   Cytokine-cytokine receptor interaction sfum04061   Viral protein interaction with cytokine and cytokine receptor sfum04062   Chemokine signaling pathway sfum04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     130026513 (CCL21)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     130026513 (CCL21)    04061 Viral protein interaction with cytokine and cytokine receptor     130026513 (CCL21)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     130026513 (CCL21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfum04052]     130026513 (CCL21) Cytokines and neuropeptides [BR:sfum04052]  Cytokines   Chemokines    130026513 (CCL21) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  130026513 NCBI-ProteinID:  XP_055973337 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MTPWRILSLLVLLLGCCTPGTQGNDGGAQDCCLKYSSKKIPARVVRSYRKQEPSLGCPLS AILFSPKKHSLPELCADPKEAWVQQLMRLLDQPPALRETSKGCRRDKSGKKGKGPKGCRR TKQSGTPKGP NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgactccctggcggattctgagcctccttgtcctgctcctgggctgctgcacccccggg acccaaggcaatgacggaggggcacaggactgctgcctcaagtacagcagcaagaagatt cccgcccgggtggtccgcagctaccgcaagcaggagccgagcttgggctgccccctctct gccatcctgttctcgcctaagaagcactccctgcccgagctgtgcgcagaccccaaggag gcctgggtgcagcaactgatgcgcctactggaccagcctcccgccctccgtgagacctcc aagggctgccggagagacaagtctggcaagaaagggaagggccccaaaggctgtaggagg accaagcagtcaggaaccccaaaagggccatag

DBGET integrated database retrieval system